SCOP 1.67: Domain d1avzb_: 1avz B:

Lineage for d1avzb_ (1avz B:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
   alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.102.1: Regulatory factor Nef [55671] (1 family)

5. Family d.102.1.1: Regulatory factor Nef [55672] (1 protein)

6. Protein Regulatory factor Nef [55673] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [55674] (4 PDB entries)

8. Domain d1avzb_: 1avz B: [40702]
   Other proteins in same PDB: d1avzc_
   mutant

Details for d1avzb_

PDB Entry: 1avz, 3 Å

PDB Description: v-1 nef protein in complex with wild type fyn sh3 domain

SCOP Domain Sequences for d1avzb_:

Sequence, based on SEQRES records:

>d1avzb_ d.102.1.1 (B:) Regulatory factor Nef {Human immunodeficiency virus type 1}
tpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
pgvrypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewrfdsrla
fhhvarelhpeyf

Sequence, based on observed residues (ATOM records):

>d1avzb_ d.102.1.1 (B:) Regulatory factor Nef {Human immunodeficiency virus type 1}
tpqvplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpg
pgvrypltfgwcyklvpvevlewrfdsrlafhhvarelhpeyf

Timeline for d1avzb_:

• d1avzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1avzb_ appears in SCOP 1.65
  
• d1avzb_ appears in SCOP 1.69
  
• d1avzb_ appears in the current release, SCOPe 2.08