Lineage for d1avza_ (1avz A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532501Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
    alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha
  4. 2532502Superfamily d.102.1: Regulatory factor Nef [55671] (2 families) (S)
  5. 2532503Family d.102.1.1: Regulatory factor Nef [55672] (2 proteins)
    automatically mapped to Pfam PF00469
  6. 2532504Protein Regulatory factor Nef [55673] (1 species)
  7. 2532505Species Human immunodeficiency virus type 1 [TaxId:11676] [55674] (4 PDB entries)
  8. 2532508Domain d1avza_: 1avz A: [40701]
    Other proteins in same PDB: d1avzc_

Details for d1avza_

PDB Entry: 1avz (more details), 3 Å

PDB Description: v-1 nef protein in complex with wild type fyn sh3 domain
PDB Compounds: (A:) negative factor

SCOPe Domain Sequences for d1avza_:

Sequence, based on SEQRES records: (download)

>d1avza_ d.102.1.1 (A:) Regulatory factor Nef {Human immunodeficiency virus type 1 [TaxId: 11676]}
vplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpgpgv
rypltfgwcyklvpvepdkveeankgentsllhpvslhgmddperevlewrfdsrlafhh
varelhpeyf

Sequence, based on observed residues (ATOM records): (download)

>d1avza_ d.102.1.1 (A:) Regulatory factor Nef {Human immunodeficiency virus type 1 [TaxId: 11676]}
vplrpmtykaavdlshflkekggleglihsqrrqdildlwiyhtqgyfpdwqnytpgpgv
rypltfgwcyklvpvevlewrfdsrlafhhvarelhpeyf

SCOPe Domain Coordinates for d1avza_:

Click to download the PDB-style file with coordinates for d1avza_.
(The format of our PDB-style files is described here.)

Timeline for d1avza_: