Lineage for d1e3pa7 (1e3p A:483-578)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.101: Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 2 and 5 [55665] (1 superfamily) Superfamily d.101.1: Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 2 and 5 [55666] (1 family) 
Family d.101.1.1: Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 2 and 5 [55667] (1 protein) Protein Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 2 and 5 [55668] (1 species) Species Streptomyces antibioticus [TaxId:1890] [55669] (2 PDB entries) 
Domain d1e3pa7: 1e3p A:483-578 [40698]
Other proteins in same PDB: d1e3pa1, d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa5
Details for d1e3pa7
PDB Entry: 1e3p (more details), 2.5 Å
PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme
SCOP Domain Sequences for d1e3pa7:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3pa7 d.101.1.1 (A:483-578) Polynucleotide phosporylase/guanosine pentaphospate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus}
apvagiamglisqeingethyvaltdilgaedafgdmdfkvagtkefvtalqldtkldgi
pasvlaaalkqardarlhildvmmeaidtpdemspn
SCOP Domain Coordinates for d1e3pa7:
Click to download the PDB-style file with coordinates for d1e3pa7.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e3pa7:
- d1e3pa7 appears in SCOP 1.57
- d1e3pa7 appears in the current release, SCOPe 2.08
View in 3D
