Lineage for d5s62e_ (5s62 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2346952Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2346953Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2346954Protein Stathmin 4 [101496] (3 species)
  7. 2346971Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (178 PDB entries)
  8. 2347066Domain d5s62e_: 5s62 E: [406968]
    Other proteins in same PDB: d5s62a1, d5s62a2, d5s62b1, d5s62b2, d5s62c1, d5s62c2, d5s62d1, d5s62d2, d5s62f1, d5s62f2, d5s62f3
    automated match to d4i55e_
    complexed with acp, ca, gdp, gtp, mes, mg, wj7

Details for d5s62e_

PDB Entry: 5s62 (more details), 2.75 Å

PDB Description: tubulin-z100642432-complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5s62e_:

Sequence, based on SEQRES records: (download)

>d5s62e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d5s62e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d5s62e_:

Click to download the PDB-style file with coordinates for d5s62e_.
(The format of our PDB-style files is described here.)

Timeline for d5s62e_: