Lineage for d5s5qd1 (5s5q D:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2471590Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries)
  8. 2471602Domain d5s5qd1: 5s5q D:1-245 [406950]
    Other proteins in same PDB: d5s5qa2, d5s5qb2, d5s5qc2, d5s5qd2, d5s5qe_, d5s5qf1, d5s5qf2, d5s5qf3
    automated match to d4drxb1
    complexed with acp, ca, gdp, gtp, hr5, mes, mg

Details for d5s5qd1

PDB Entry: 5s5q (more details), 2.05 Å

PDB Description: tubulin-z396380540-complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5s5qd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s5qd1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5s5qd1:

Click to download the PDB-style file with coordinates for d5s5qd1.
(The format of our PDB-style files is described here.)

Timeline for d5s5qd1: