Lineage for d5s5pd1 (5s5p D:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863308Protein automated matches [226837] (9 species)
    not a true protein
  7. 2863314Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)
  8. 2863678Domain d5s5pd1: 5s5p D:1-245 [406948]
    Other proteins in same PDB: d5s5pa2, d5s5pb2, d5s5pc2, d5s5pd2, d5s5pe_, d5s5pf1, d5s5pf2, d5s5pf3
    automated match to d4drxb1
    complexed with acp, ca, gdp, gtp, mes, mg, vvg

Details for d5s5pd1

PDB Entry: 5s5p (more details), 2.79 Å

PDB Description: tubulin-z53825177-complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5s5pd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s5pd1 c.32.1.1 (D:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d5s5pd1:

Click to download the PDB-style file with coordinates for d5s5pd1.
(The format of our PDB-style files is described here.)

Timeline for d5s5pd1: