Lineage for d1diva2 (1div A:1-55)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208184Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2208185Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2208186Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2208187Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2208188Species Bacillus stearothermophilus [TaxId:1422] [55661] (5 PDB entries)
  8. 2208193Domain d1diva2: 1div A:1-55 [40693]
    Other proteins in same PDB: d1diva1

Details for d1diva2

PDB Entry: 1div (more details), 2.6 Å

PDB Description: ribosomal protein l9
PDB Compounds: (A:) ribosomal protein l9

SCOPe Domain Sequences for d1diva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diva2 d.100.1.1 (A:1-55) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

SCOPe Domain Coordinates for d1diva2:

Click to download the PDB-style file with coordinates for d1diva2.
(The format of our PDB-style files is described here.)

Timeline for d1diva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diva1