Lineage for d1diva2 (1div A:1-55)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730589Fold d.100: L9 N-domain-like [55657] (1 superfamily)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 730590Superfamily d.100.1: L9 N-domain-like [55658] (2 families) (S)
  5. 730591Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
  6. 730592Protein Ribosomal protein L9 N-domain [55660] (2 species)
  7. 730593Species Bacillus stearothermophilus [TaxId:1422] [55661] (7 PDB entries)
  8. 730595Domain d1diva2: 1div A:1-55 [40693]
    Other proteins in same PDB: d1diva1

Details for d1diva2

PDB Entry: 1div (more details), 2.6 Å

PDB Description: ribosomal protein l9
PDB Compounds: (A:) ribosomal protein l9

SCOP Domain Sequences for d1diva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diva2 d.100.1.1 (A:1-55) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

SCOP Domain Coordinates for d1diva2:

Click to download the PDB-style file with coordinates for d1diva2.
(The format of our PDB-style files is described here.)

Timeline for d1diva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1diva1