Lineage for d1div_2 (1div 1-55)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 608762Fold d.100: L9 N-domain-like [55657] (1 superfamily)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 608763Superfamily d.100.1: L9 N-domain-like [55658] (2 families) (S)
  5. 608764Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
  6. 608765Protein Ribosomal protein L9 N-domain [55660] (1 species)
  7. 608766Species Bacillus stearothermophilus [TaxId:1422] [55661] (2 PDB entries)
  8. 608767Domain d1div_2: 1div 1-55 [40693]
    Other proteins in same PDB: d1div_1

Details for d1div_2

PDB Entry: 1div (more details), 2.6 Å

PDB Description: ribosomal protein l9

SCOP Domain Sequences for d1div_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1div_2 d.100.1.1 (1-55) Ribosomal protein L9 N-domain {Bacillus stearothermophilus}
mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeq

SCOP Domain Coordinates for d1div_2:

Click to download the PDB-style file with coordinates for d1div_2.
(The format of our PDB-style files is described here.)

Timeline for d1div_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1div_1