SCOP 1.75: Domain d1diva1: 1div A:56-149

Lineage for d1diva1 (1div A:56-149)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
   alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta

4. Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family)

5. Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)

6. Protein Ribosomal protein L9 C-domain [55655] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55656] (5 PDB entries)

8. Domain d1diva1: 1div A:56-149 [40692]
   Other proteins in same PDB: d1diva2

Details for d1diva1

PDB Entry: 1div, 2.6 Å

PDB Description: ribosomal protein l9

PDB Compounds: (A:) ribosomal protein l9

SCOP Domain Sequences for d1diva1:

Sequence; same for both SEQRES and ATOM records:

>d1diva1 d.99.1.1 (A:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

Timeline for d1diva1:

• d1diva1 first appeared (with stable ids) in SCOP 1.55, called d1div_1
  
• d1diva1 appears in SCOP 1.73
  
• d1diva1 appears in SCOPe 2.01
  
• d1diva1 appears in the current release, SCOPe 2.08