Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries) |
Domain d5s58c2: 5s58 C:246-440 [406868] Other proteins in same PDB: d5s58a1, d5s58b1, d5s58c1, d5s58d1, d5s58e_, d5s58f1, d5s58f2, d5s58f3 automated match to d4i50a2 complexed with acp, ca, gdp, gtp, mes, mg, nuy |
PDB Entry: 5s58 (more details), 2.3 Å
SCOPe Domain Sequences for d5s58c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5s58c2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgvdsv
Timeline for d5s58c2: