SCOP 1.57: Domain d1buhb_: 1buh B:

Lineage for d1buhb_ (1buh B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)

4. Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family)

5. Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)

6. Protein CksHs1 [55645] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55646] (3 PDB entries)

8. Domain d1buhb_: 1buh B: [40686]
   Other proteins in same PDB: d1buha_

Details for d1buhb_

PDB Entry: 1buh, 2.6 Å

PDB Description: crystal structure of the human cdk2 kinase complex with cell cycle-regulatory protein ckshs1

SCOP Domain Sequences for d1buhb_:

Sequence; same for both SEQRES and ATOM records:

>d1buhb_ d.97.1.1 (B:) CksHs1 {Human (Homo sapiens)}
qiyysdkyddeefeyrhvmlpkdiaklvpkthlmsesewrnlgvqqsqgwvhymihepep
hillfrrplp

Timeline for d1buhb_:

• d1buhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1buhb_ appears in SCOP 1.59
  
• d1buhb_ appears in the current release, SCOPe 2.08