Lineage for d1cksb_ (1cks B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920163Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 1920164Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 1920165Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 1920180Protein CksHs2 [55643] (1 species)
  7. 1920181Species Human (Homo sapiens) [TaxId:9606] [55644] (1 PDB entry)
  8. 1920183Domain d1cksb_: 1cks B: [40684]
    complexed with so4

Details for d1cksb_

PDB Entry: 1cks (more details), 2.1 Å

PDB Description: human ckshs2 atomic structure: a role for its hexameric assembly in cell cycle control
PDB Compounds: (B:) cyclin-dependent kinase subunit, type 2

SCOPe Domain Sequences for d1cksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cksb_ d.97.1.1 (B:) CksHs2 {Human (Homo sapiens) [TaxId: 9606]}
ahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihe
pephillfrrplpkdqqk

SCOPe Domain Coordinates for d1cksb_:

Click to download the PDB-style file with coordinates for d1cksb_.
(The format of our PDB-style files is described here.)

Timeline for d1cksb_: