![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) |
![]() | Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
![]() | Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
![]() | Protein CksHs2 [55643] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55644] (1 PDB entry) |
![]() | Domain d1cksa_: 1cks A: [40683] |
PDB Entry: 1cks (more details), 2.1 Å
SCOP Domain Sequences for d1cksa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cksa_ d.97.1.1 (A:) CksHs2 {Human (Homo sapiens)} ahkqiyysdkyfdehyeyrhvmlprelskqvpkthlmseeewrrlgvqqslgwvhymihe pephillfrrplpk
Timeline for d1cksa_: