Lineage for d1qb3c_ (1qb3 C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82812Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
  4. 82813Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 82814Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 82815Protein cks1 [55641] (1 species)
  7. 82816Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55642] (1 PDB entry)
  8. 82819Domain d1qb3c_: 1qb3 C: [40682]

Details for d1qb3c_

PDB Entry: 1qb3 (more details), 3 Å

PDB Description: crystal structure of the cell cycle regulatory protein cks1

SCOP Domain Sequences for d1qb3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qb3c_ d.97.1.1 (C:) cks1 {Baker's yeast (Saccharomyces cerevisiae)}
hafqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgt
lriltedewrglgitqslgwehyechapephillfkrplnyeaelraat

SCOP Domain Coordinates for d1qb3c_:

Click to download the PDB-style file with coordinates for d1qb3c_.
(The format of our PDB-style files is described here.)

Timeline for d1qb3c_: