Lineage for d5s5aa2 (5s5a A:246-438)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959219Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)
  8. 2959366Domain d5s5aa2: 5s5a A:246-438 [406782]
    Other proteins in same PDB: d5s5aa1, d5s5ab1, d5s5ac1, d5s5ad1, d5s5ae_, d5s5af1, d5s5af2, d5s5af3
    automated match to d4i50a2
    complexed with acp, ca, gdp, gtp, mes, mg, wzy

Details for d5s5aa2

PDB Entry: 5s5a (more details), 2.35 Å

PDB Description: tubulin-z1449748885-complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5s5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s5aa2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

SCOPe Domain Coordinates for d5s5aa2:

Click to download the PDB-style file with coordinates for d5s5aa2.
(The format of our PDB-style files is described here.)

Timeline for d5s5aa2: