SCOPe 2.06: Domain d1b9lf_: 1b9l F:

Lineage for d1b9lf_ (1b9l F:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins)
   beta-sheets of four subunits form a barrel, closed: n=16, S=16
   automatically mapped to Pfam PF02152

6. Protein 7,8-dihydroneopterin triphosphate epimerase [55631] (1 species)

7. Species Escherichia coli [TaxId:562] [55632] (1 PDB entry)

8. Domain d1b9lf_: 1b9l F: [40670]

Details for d1b9lf_

PDB Entry: 1b9l, 2.9 Å

PDB Description: 7,8-dihydroneopterin triphosphate epimerase

PDB Compounds: (F:) protein (epimerase)

SCOPe Domain Sequences for d1b9lf_:

Sequence; same for both SEQRES and ATOM records:

>d1b9lf_ d.96.1.3 (F:) 7,8-dihydroneopterin triphosphate epimerase {Escherichia coli [TaxId: 562]}
aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr

Timeline for d1b9lf_:

• d1b9lf_ first appeared (with stable ids) in SCOP 1.55
  
• d1b9lf_ appears in SCOPe 2.05
  
• d1b9lf_ appears in SCOPe 2.07
  
• d1b9lf_ appears in the current release, SCOPe 2.08