Lineage for d1b9lf_ (1b9l F:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.96: T-fold [55619] (1 superfamily) Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) 
Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins) 
Protein 7,8-dihydroneopterin triphosphate epimerase [55631] (1 species) Species Escherichia coli [TaxId:562] [55632] (1 PDB entry) 
Domain d1b9lf_: 1b9l F: [40670]
Details for d1b9lf_
PDB Entry: 1b9l (more details), 2.9 Å
PDB Description: 7,8-dihydroneopterin triphosphate epimerase
SCOP Domain Sequences for d1b9lf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b9lf_ d.96.1.3 (F:) 7,8-dihydroneopterin triphosphate epimerase {Escherichia coli}
aqpaaiiriknlrlrtfigikeeeinnrqdivinvtihypadkartsedindalnyrtvt
kniiqhvennrfsllekltqdvldiarehhwvtyaeveidklhalryadsvsmtlswqr
SCOP Domain Coordinates for d1b9lf_:
Click to download the PDB-style file with coordinates for d1b9lf_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b9lf_:
- d1b9lf_ appears in SCOP 1.57
- d1b9lf_ appears in the current release, SCOPe 2.08
View in 3D
