SCOPe 2.08: Domain d5s5ad2: 5s5a D:246-441

Lineage for d5s5ad2 (5s5a D:246-441)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

Domain d5s5ad2: 5s5a D:246-441 [406646]
Other proteins in same PDB: d5s5aa1, d5s5ab1, d5s5ac1, d5s5ad1, d5s5ae_, d5s5af1, d5s5af2, d5s5af3
automated match to d3rycd2
complexed with acp, ca, gdp, gtp, mes, mg, wzy

Details for d5s5ad2

PDB Entry: 5s5a (more details), 2.35 Å

PDB Description: tubulin-z1449748885-complex

PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5s5ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s5ad2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

SCOPe Domain Coordinates for d5s5ad2:

Click to download the PDB-style file with coordinates for d5s5ad2.
(The format of our PDB-style files is described here.)

Timeline for d5s5ad2: