Lineage for d2dhn__ (2dhn -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 508755Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 508756Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 508911Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
  6. 508912Protein 7,8-dihydroneopterin aldolase [55629] (3 species)
  7. 508922Species Staphylococcus aureus [TaxId:1280] [55630] (10 PDB entries)
  8. 508924Domain d2dhn__: 2dhn - [40664]

Details for d2dhn__

PDB Entry: 2dhn (more details), 2.2 Å

PDB Description: complex of 7,8-dihydroneopterin aldolase from staphylococcus aureus with 6-hydroxymethyl-7,8-dihydropterin at 2.2 a resolution

SCOP Domain Sequences for d2dhn__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dhn__ d.96.1.3 (-) 7,8-dihydroneopterin aldolase {Staphylococcus aureus}
mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
k

SCOP Domain Coordinates for d2dhn__:

Click to download the PDB-style file with coordinates for d2dhn__.
(The format of our PDB-style files is described here.)

Timeline for d2dhn__: