SCOP 1.57: Domain d2dhn__: 2dhn -

Lineage for d2dhn__ (2dhn -)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.96: T-fold [55619] (1 superfamily)

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families)

5. Family d.96.1.3: DHN aldolase/epimerase [55628] (2 proteins)

6. Protein 7,8-dihidroneopterin aldolase [55629] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [55630] (2 PDB entries)

8. Domain d2dhn__: 2dhn - [40664]

Details for d2dhn__

PDB Entry: 2dhn, 2.2 Å

PDB Description: complex of 7,8-dihydroneopterin aldolase from staphylococcus aureus with 6-hydroxymethyl-7,8-dihydropterin at 2.2 a resolution

SCOP Domain Sequences for d2dhn__:

Sequence; same for both SEQRES and ATOM records:

>d2dhn__ d.96.1.3 (-) 7,8-dihidroneopterin aldolase {Staphylococcus aureus}
mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
k

Timeline for d2dhn__:

• d2dhn__ first appeared (with stable ids) in SCOP 1.55
  
• d2dhn__ appears in SCOP 1.59
  
• d2dhn__ appears in the current release, SCOPe 2.08, called d2dhna_