| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins) beta-sheets of four subunits form a barrel, closed: n=16, S=16 automatically mapped to Pfam PF02152 |
| Protein 7,8-dihydroneopterin aldolase [55629] (4 species) |
| Species Staphylococcus aureus [TaxId:1280] [55630] (13 PDB entries) Uniprot P56740 |
| Domain d2dhna_: 2dhn A: [40664] complexed with ph2 |
PDB Entry: 2dhn (more details), 2.2 Å
SCOPe Domain Sequences for d2dhna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dhna_ d.96.1.3 (A:) 7,8-dihydroneopterin aldolase {Staphylococcus aureus [TaxId: 1280]}
mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
k
Timeline for d2dhna_: