Lineage for d1dhna_ (1dhn A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins)
    beta-sheets of four subunits form a barrel, closed: n=16, S=16
    automatically mapped to Pfam PF02152
  6. Protein 7,8-dihydroneopterin aldolase [55629] (4 species)
  7. Species Staphylococcus aureus [TaxId:1280] [55630] (13 PDB entries)
    Uniprot P56740
  8. Domain d1dhna_: 1dhn A: [40663]

Details for d1dhna_

PDB Entry: 1dhn (more details), 1.65 Å

PDB Description: 1.65 angstrom resolution structure of 7,8-dihydroneopterin aldolase from staphylococcus aureus
PDB Compounds: (A:) 7,8-dihydroneopterin aldolase

SCOPe Domain Sequences for d1dhna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dhna_ d.96.1.3 (A:) 7,8-dihydroneopterin aldolase {Staphylococcus aureus [TaxId: 1280]}
mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
k

SCOPe Domain Coordinates for d1dhna_ are not available.

Timeline for d1dhna_: