Lineage for d5s5fa2 (5s5f A:246-437)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2565863Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)
  8. 2565915Domain d5s5fa2: 5s5f A:246-437 [406610]
    Other proteins in same PDB: d5s5fa1, d5s5fb1, d5s5fc1, d5s5fd1, d5s5fe_, d5s5ff1, d5s5ff2, d5s5ff3
    automated match to d4i50a2
    complexed with acp, ca, gdp, gtp, mes, mg, uqm

Details for d5s5fa2

PDB Entry: 5s5f (more details), 2.24 Å

PDB Description: tubulin-z87615031-complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5s5fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s5fa2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d5s5fa2:

Click to download the PDB-style file with coordinates for d5s5fa2.
(The format of our PDB-style files is described here.)

Timeline for d5s5fa2: