Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (7 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries) |
Domain d5s66d2: 5s66 D:246-441 [406600] Other proteins in same PDB: d5s66b1, d5s66c1, d5s66d1, d5s66e_, d5s66f1, d5s66f2 automated match to d3rycd2 complexed with acp, gdp, gtp, lvv, mes, mg |
PDB Entry: 5s66 (more details), 2.1 Å
SCOPe Domain Sequences for d5s66d2:
Sequence, based on SEQRES records: (download)
>d5s66d2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
>d5s66d2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]} gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad
Timeline for d5s66d2: