Lineage for d1fb1e_ (1fb1 E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2572796Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2572797Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2572798Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. 2572799Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 2572906Species Human (Homo sapiens) [TaxId:9606] [55624] (1 PDB entry)
  8. 2572911Domain d1fb1e_: 1fb1 E: [40656]
    complexed with ipa, zn

Details for d1fb1e_

PDB Entry: 1fb1 (more details), 3.1 Å

PDB Description: crystal structure of human gtp cyclohydrolase i
PDB Compounds: (E:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1fb1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb1e_ d.96.1.1 (E:) GTP cyclohydrolase I {Human (Homo sapiens) [TaxId: 9606]}
gerprseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetis
dvlndaifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklarivei
ysrrlqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvf
redpktreefltlirs

SCOPe Domain Coordinates for d1fb1e_:

Click to download the PDB-style file with coordinates for d1fb1e_.
(The format of our PDB-style files is described here.)

Timeline for d1fb1e_: