Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein) |
Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [311384] (170 PDB entries) |
Domain d5s50f1: 5s50 F:1-76 [406551] Other proteins in same PDB: d5s50a1, d5s50a2, d5s50b1, d5s50b2, d5s50c1, d5s50c2, d5s50d1, d5s50d2, d5s50e_, d5s50f2, d5s50f3 automated match to d3tiia1 complexed with acp, ca, gdp, gtp, mes, mg, wzd |
PDB Entry: 5s50 (more details), 3.1 Å
SCOPe Domain Sequences for d5s50f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5s50f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq lvnyyrgadklcrkas
Timeline for d5s50f1: