Lineage for d1fb1d_ (1fb1 D:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34770Fold d.96: T-fold [55619] (1 superfamily)
  4. 34771Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
  5. 34772Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 34773Protein GTP cyclohydrolase I [55622] (2 species)
  7. 34840Species Human (Homo sapiens) [TaxId:9606] [55624] (1 PDB entry)
  8. 34844Domain d1fb1d_: 1fb1 D: [40655]

Details for d1fb1d_

PDB Entry: 1fb1 (more details), 3.1 Å

PDB Description: crystal structure of human gtp cyclohydrolase i

SCOP Domain Sequences for d1fb1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb1d_ d.96.1.1 (D:) GTP cyclohydrolase I {Human (Homo sapiens)}
gerprseednelnlpnlaaayssilsslgenpqrqgllktpwraasamqfftkgyqetis
dvlndaifdedhdemvivkdidmfsmcehhlvpfvgkvhigylpnkqvlglsklarivei
ysrrlqvqerltkqiavaitealrpagvgvvveathmcmvmrgvqkmnsktvtstmlgvf
redpktreefltlirs

SCOP Domain Coordinates for d1fb1d_:

Click to download the PDB-style file with coordinates for d1fb1d_.
(The format of our PDB-style files is described here.)

Timeline for d1fb1d_: