Lineage for d6p5za1 (6p5z A:1-113)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845736Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins)
  6. 2845742Protein Siroheme synthase CysG, domain 1 [102163] (2 species)
  7. 2845746Species Salmonella typhimurium [TaxId:90371] [102164] (5 PDB entries)
  8. 2845749Domain d6p5za1: 6p5z A:1-113 [406509]
    Other proteins in same PDB: d6p5za2, d6p5za3, d6p5zb2, d6p5zb3
    automated match to d1pjta1
    complexed with cl, f0x, sah

Details for d6p5za1

PDB Entry: 6p5z (more details), 2.26 Å

PDB Description: cobalt-sirohydrochlorin-bound s. typhimurium siroheme synthase
PDB Compounds: (A:) Siroheme synthase

SCOPe Domain Sequences for d6p5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6p5za1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]}
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim

SCOPe Domain Coordinates for d6p5za1:

Click to download the PDB-style file with coordinates for d6p5za1.
(The format of our PDB-style files is described here.)

Timeline for d6p5za1: