| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
| Family a.137.10.1: Stathmin [101495] (2 proteins) |
| Protein Stathmin 4 [101496] (3 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
| Domain d5s65e_: 5s65 E: [406503] Other proteins in same PDB: d5s65a1, d5s65a2, d5s65b1, d5s65b2, d5s65c1, d5s65c2, d5s65d1, d5s65d2, d5s65f1, d5s65f2, d5s65f3 automated match to d4i55e_ complexed with acp, ca, gdp, gtp, mes, mg, x1j |
PDB Entry: 5s65 (more details), 2.25 Å
SCOPe Domain Sequences for d5s65e_:
Sequence, based on SEQRES records: (download)
>d5s65e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea
>d5s65e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea
Timeline for d5s65e_: