SCOPe 2.08: Domain d5s4zc1: 5s4z C:1-245

Lineage for d5s4zc1 (5s4z C:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226564] (136 PDB entries)

8. Domain d5s4zc1: 5s4z C:1-245 [406488]
   Other proteins in same PDB: d5s4za2, d5s4zb2, d5s4zc2, d5s4zd2, d5s4ze_, d5s4zf1, d5s4zf2, d5s4zf3
   automated match to d5fnva1
   complexed with acp, ca, gdp, gtp, mes, mg, wn1

Details for d5s4zc1

PDB Entry: 5s4z, 2.1 Å

PDB Description: tubulin-z28290384-complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5s4zc1:

Sequence; same for both SEQRES and ATOM records:

>d5s4zc1 c.32.1.1 (C:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5s4zc1:

• d5s4zc1 first appeared in SCOPe 2.07