SCOPe 2.08: Domain d5s55f1: 5s55 F:1-76

Lineage for d5s55f1 (5s55 F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)

8. Domain d5s55f1: 5s55 F:1-76 [406451]
   Other proteins in same PDB: d5s55a1, d5s55a2, d5s55b1, d5s55b2, d5s55c1, d5s55c2, d5s55d1, d5s55d2, d5s55e_, d5s55f2, d5s55f3
   automated match to d3tiia1
   complexed with acp, ca, gdp, gtp, mg, wzp

Details for d5s55f1

PDB Entry: 5s55, 2.3 Å

PDB Description: tubulin-z106307058-complex

PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d5s55f1:

Sequence; same for both SEQRES and ATOM records:

>d5s55f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d5s55f1:

• d5s55f1 first appeared in SCOPe 2.07