Lineage for d5s59a1 (5s59 A:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2471420Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2471421Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2471422Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2471549Protein automated matches [226837] (10 species)
    not a true protein
  7. 2471590Species Cow (Bos taurus) [TaxId:9913] [226564] (128 PDB entries)
  8. 2471863Domain d5s59a1: 5s59 A:1-245 [406438]
    Other proteins in same PDB: d5s59a2, d5s59b2, d5s59c2, d5s59d2, d5s59e_, d5s59f1, d5s59f2, d5s59f3
    automated match to d5fnva1
    complexed with acp, ca, gdp, gtp, mes, mg, ur1

Details for d5s59a1

PDB Entry: 5s59 (more details), 2.6 Å

PDB Description: tubulin-z1324080698-complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5s59a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s59a1 c.32.1.1 (A:1-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

SCOPe Domain Coordinates for d5s59a1:

Click to download the PDB-style file with coordinates for d5s59a1.
(The format of our PDB-style files is described here.)

Timeline for d5s59a1: