Lineage for d5s5jd2 (5s5j D:246-441)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2565735Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2565736Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2565857Protein automated matches [227071] (7 species)
    not a true protein
  7. 2565863Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)
  8. 2565922Domain d5s5jd2: 5s5j D:246-441 [406423]
    Other proteins in same PDB: d5s5ja1, d5s5jb1, d5s5jc1, d5s5jd1, d5s5je_, d5s5jf1, d5s5jf2, d5s5jf3
    automated match to d3rycd2
    complexed with acp, ca, gdp, gtp, mes, mg, wky

Details for d5s5jd2

PDB Entry: 5s5j (more details), 2.25 Å

PDB Description: tubulin-z1148747945-complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5s5jd2:

Sequence, based on SEQRES records: (download)

>d5s5jd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5s5jd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsltvpeltqqmfdsknmmaacdprhg
ryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfi
gnstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
tad

SCOPe Domain Coordinates for d5s5jd2:

Click to download the PDB-style file with coordinates for d5s5jd2.
(The format of our PDB-style files is described here.)

Timeline for d5s5jd2: