| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein automated matches [227071] (7 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries) |
| Domain d5s51a2: 5s51 A:246-438 [406380] Other proteins in same PDB: d5s51a1, d5s51b1, d5s51c1, d5s51d1, d5s51e_, d5s51f1, d5s51f2, d5s51f3 automated match to d4i50a2 complexed with acp, ca, gdp, gtp, mes, mg, rws |
PDB Entry: 5s51 (more details), 2.4 Å
SCOPe Domain Sequences for d5s51a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5s51a2 d.79.2.1 (A:246-438) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd
Timeline for d5s51a2: