SCOPe 2.07: Domain d5s4oc2: 5s4o C:246-440

Lineage for d5s4oc2 (5s4o C:246-440)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (145 PDB entries)

Domain d5s4oc2: 5s4o C:246-440 [406372]
Other proteins in same PDB: d5s4oa1, d5s4ob1, d5s4oc1, d5s4od1, d5s4oe_, d5s4of1, d5s4of2, d5s4of3
automated match to d4i50a2
complexed with acp, ca, gdp, gtp, mes, mg, o0j

Details for d5s4oc2

PDB Entry: 5s4o (more details), 2.3 Å

PDB Description: tubulin-z48847594-complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5s4oc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s4oc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5s4oc2:

Click to download the PDB-style file with coordinates for d5s4oc2.
(The format of our PDB-style files is described here.)

Timeline for d5s4oc2: