SCOPe 2.08: Domain d5s52e_: 5s52 E:

Lineage for d5s52e_ (5s52 E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d5s52e_: 5s52 E: [406370]
   Other proteins in same PDB: d5s52a1, d5s52a2, d5s52b1, d5s52b2, d5s52c1, d5s52c2, d5s52d1, d5s52d2, d5s52f1, d5s52f2, d5s52f3
   automated match to d4i55e_
   complexed with acp, ca, gdp, gtp, mes, mg, w1p

Details for d5s52e_

PDB Entry: 5s52, 2.83 Å

PDB Description: tubulin-z50145861-complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5s52e_:

Sequence, based on SEQRES records:

>d5s52e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records):

>d5s52e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

Timeline for d5s52e_:

• d5s52e_ first appeared in SCOPe 2.07