![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins) |
![]() | Protein Siroheme synthase CysG, domain 1 [102163] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [102164] (5 PDB entries) |
![]() | Domain d6p5zb1: 6p5z B:1-113 [406343] Other proteins in same PDB: d6p5za2, d6p5za3, d6p5zb2, d6p5zb3 automated match to d1pjta1 complexed with cl, f0x, sah |
PDB Entry: 6p5z (more details), 2.26 Å
SCOPe Domain Sequences for d6p5zb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6p5zb1 c.2.1.11 (B:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim
Timeline for d6p5zb1: