SCOPe 2.08: Domain d5s59f1: 5s59 F:1-76

Lineage for d5s59f1 (5s59 F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein)

6. Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries)

8. Domain d5s59f1: 5s59 F:1-76 [406338]
   Other proteins in same PDB: d5s59a1, d5s59a2, d5s59b1, d5s59b2, d5s59c1, d5s59c2, d5s59d1, d5s59d2, d5s59e_, d5s59f2, d5s59f3
   automated match to d3tiia1
   complexed with acp, ca, gdp, gtp, mes, mg, ur1

Details for d5s59f1

PDB Entry: 5s59, 2.6 Å

PDB Description: tubulin-z1324080698-complex

PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d5s59f1:

Sequence; same for both SEQRES and ATOM records:

>d5s59f1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d5s59f1:

• d5s59f1 first appeared in SCOPe 2.07