SCOPe 2.08: Domain d5s5le_: 5s5l E:

Lineage for d5s5le_ (5s5l E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.10: Stathmin [101494] (1 family)
   single long helix crosslinking four tubulin subunits
   automatically mapped to Pfam PF00836

5. Family a.137.10.1: Stathmin [101495] (2 proteins)

6. Protein Stathmin 4 [101496] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)

8. Domain d5s5le_: 5s5l E: [406287]
   Other proteins in same PDB: d5s5la1, d5s5la2, d5s5lb1, d5s5lb2, d5s5lc1, d5s5lc2, d5s5ld1, d5s5ld2, d5s5lf1, d5s5lf2, d5s5lf3
   automated match to d4i55e_
   complexed with acp, ca, gdp, gtp, mes, mg, x0m

Details for d5s5le_

PDB Entry: 5s5l, 2.25 Å

PDB Description: tubulin-z1492796719-complex

PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5s5le_:

Sequence, based on SEQRES records:

>d5s5le_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkee

Sequence, based on observed residues (ATOM records):

>d5s5le_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppdpsleeiqkkleaaeerrkyqeaellkhlaekrehere
viqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelke
e

Timeline for d5s5le_:

• d5s5le_ first appeared in SCOPe 2.07