SCOPe 2.08: Domain d5s4qc2: 5s4q C:246-440

Lineage for d5s4qc2 (5s4q C:246-440)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Cow (Bos taurus) [TaxId:9913] [226565] (136 PDB entries)

Domain d5s4qc2: 5s4q C:246-440 [406266]
Other proteins in same PDB: d5s4qa1, d5s4qb1, d5s4qc1, d5s4qd1, d5s4qe_, d5s4qf1, d5s4qf2, d5s4qf3
automated match to d4i50a2
complexed with acp, ca, gdp, gtp, mes, mg, wvd

Details for d5s4qc2

PDB Entry: 5s4q (more details), 2.59 Å

PDB Description: tubulin-z422344882-complex

PDB Compounds: (C:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5s4qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5s4qc2 d.79.2.1 (C:246-440) automated matches {Cow (Bos taurus) [TaxId: 9913]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5s4qc2:

Click to download the PDB-style file with coordinates for d5s4qc2.
(The format of our PDB-style files is described here.)

Timeline for d5s4qc2: