Lineage for d5s4ye_ (5s4y E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2733971Domain d5s4ye_: 5s4y E: [406263]
    Other proteins in same PDB: d5s4ya1, d5s4ya2, d5s4yb1, d5s4yb2, d5s4yc1, d5s4yc2, d5s4yd1, d5s4yd2, d5s4yf1, d5s4yf2, d5s4yf3
    automated match to d4i55e_
    complexed with acp, ca, gdp, gtp, mg, nsj

Details for d5s4ye_

PDB Entry: 5s4y (more details), 2.3 Å

PDB Description: tubulin-z2856434857-complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5s4ye_:

Sequence, based on SEQRES records: (download)

>d5s4ye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d5s4ye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d5s4ye_:

Click to download the PDB-style file with coordinates for d5s4ye_.
(The format of our PDB-style files is described here.)

Timeline for d5s4ye_: