Lineage for d7o6ec_ (7o6e C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2317704Species Mycobacterium tuberculosis [TaxId:83332] [196063] (3 PDB entries)
  8. 2317713Domain d7o6ec_: 7o6e C: [406235]
    automated match to d4ztta_

Details for d7o6ec_

PDB Entry: 7o6e (more details), 2.1 Å

PDB Description: 2.12 a cryo-em structure of mycobacterium tuberculosis ferritin
PDB Compounds: (C:) Ferritin BfrB

SCOPe Domain Sequences for d7o6ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7o6ec_ a.25.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
egpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvq
hlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqf
mqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggrl

SCOPe Domain Coordinates for d7o6ec_:

Click to download the PDB-style file with coordinates for d7o6ec_.
(The format of our PDB-style files is described here.)

Timeline for d7o6ec_: