![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
![]() | Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
![]() | Protein automated matches [320245] (3 species) not a true protein |
![]() | Species Methermicoccus shengliensis [TaxId:1122233] [405898] (1 PDB entry) |
![]() | Domain d7nkgf_: 7nkg F: [406210] Other proteins in same PDB: d7nkga1, d7nkga2, d7nkgb1, d7nkgb2, d7nkgd1, d7nkgd2, d7nkge1, d7nkge2, d7nkgg1, d7nkgg2, d7nkgh1, d7nkgh2, d7nkgj1, d7nkgj2, d7nkgk1, d7nkgk2 automated match to d1e6yc_ complexed with com, f43, gol, k, so4, tp7 |
PDB Entry: 7nkg (more details), 1.6 Å
SCOPe Domain Sequences for d7nkgf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nkgf_ d.58.31.1 (F:) automated matches {Methermicoccus shengliensis [TaxId: 1122233]} ayepqyypgntsvaqnrrkhmsgnveklreisdedltailghrapgsdypsthpplaemg epdcpireiveptpgaaagdriryvqwtdsmynapatpywrsyyaainhrgvdpgtlsgr qivearerdvevygkmsietemtcpalaglrgatvhghscrlqedgvmfdmldrrrlegg tiimdkdqvgvpldrkvdlgkpmseeeaakrttiyrvdnvpfrsdsevvewvqriwelrt rygfqpq
Timeline for d7nkgf_: