Lineage for d7o6ek_ (7o6e K:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704455Species Mycobacterium tuberculosis [TaxId:83332] [196063] (3 PDB entries)
  8. 2704472Domain d7o6ek_: 7o6e K: [406164]
    automated match to d4ztta_

Details for d7o6ek_

PDB Entry: 7o6e (more details), 2.1 Å

PDB Description: 2.12 a cryo-em structure of mycobacterium tuberculosis ferritin
PDB Compounds: (K:) Ferritin BfrB

SCOPe Domain Sequences for d7o6ek_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7o6ek_ a.25.1.0 (K:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
egpktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvq
hlldrdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqf
mqwflqeqieevalmatlvrvadraganlfelenfvarevdvapaasgaphaaggrl

SCOPe Domain Coordinates for d7o6ek_:

Click to download the PDB-style file with coordinates for d7o6ek_.
(The format of our PDB-style files is described here.)

Timeline for d7o6ek_: