Class b: All beta proteins [48724] (178 folds) |
Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) |
Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
Protein automated matches [190333] (6 species) not a true protein |
Species Chimpanzee adenovirus y25 [TaxId:1123958] [406124] (1 PDB entry) |
Domain d7op2f_: 7op2 F: [406132] automated match to d1knba_ complexed with ca, edo, trs |
PDB Entry: 7op2 (more details), 1.59 Å
SCOPe Domain Sequences for d7op2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7op2f_ b.21.1.1 (F:) automated matches {Chimpanzee adenovirus y25 [TaxId: 1123958]} kltlwttpdpspncqllsdrdakftlcltkcgsqilgtvavaavtvgsalnpindtvksa ivflrfdsdgvlmsnssmvgdywnfregqttqsvaytnavgfmpnlgaypktqsktpkns ivsqvylngettmpmtltitfngtdekdttpvstysmtftwqwtgdykdknitfatnsft fsymaqe
Timeline for d7op2f_: