Lineage for d7op2f_ (7op2 F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2386499Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2386500Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2386501Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2386631Protein automated matches [190333] (6 species)
    not a true protein
  7. 2386662Species Chimpanzee adenovirus y25 [TaxId:1123958] [406124] (1 PDB entry)
  8. 2386668Domain d7op2f_: 7op2 F: [406132]
    automated match to d1knba_
    complexed with ca, edo, trs

Details for d7op2f_

PDB Entry: 7op2 (more details), 1.59 Å

PDB Description: chadox1/ chimpanzee adenovirus y25 fiber knob protein
PDB Compounds: (F:) Fiber

SCOPe Domain Sequences for d7op2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7op2f_ b.21.1.1 (F:) automated matches {Chimpanzee adenovirus y25 [TaxId: 1123958]}
kltlwttpdpspncqllsdrdakftlcltkcgsqilgtvavaavtvgsalnpindtvksa
ivflrfdsdgvlmsnssmvgdywnfregqttqsvaytnavgfmpnlgaypktqsktpkns
ivsqvylngettmpmtltitfngtdekdttpvstysmtftwqwtgdykdknitfatnsft
fsymaqe

SCOPe Domain Coordinates for d7op2f_:

Click to download the PDB-style file with coordinates for d7op2f_.
(The format of our PDB-style files is described here.)

Timeline for d7op2f_: