Lineage for d7ob1a1 (7ob1 A:2-411)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418888Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) (S)
  5. 2418956Family b.69.7.0: automated matches [227149] (1 protein)
    not a true family
  6. 2418957Protein automated matches [226853] (5 species)
    not a true protein
  7. 2418972Species Serratia proteamaculans [TaxId:28151] [395711] (5 PDB entries)
  8. 2418975Domain d7ob1a1: 7ob1 A:2-411 [406114]
    Other proteins in same PDB: d7ob1a2, d7ob1a3
    automated match to d3iuja1
    complexed with spm

Details for d7ob1a1

PDB Entry: 7ob1 (more details), 2 Å

PDB Description: oligopeptidase b from s. proteomaculans with modified hinge
PDB Compounds: (A:) oligopeptidase b

SCOPe Domain Sequences for d7ob1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ob1a1 b.69.7.0 (A:2-411) automated matches {Serratia proteamaculans [TaxId: 28151]}
mtppkaekrpypitthgdtrvddyywlrddertdpqvldylqaenaftdaalkpqqalre
tlyeemvarenlyfqsvpyvrhgyryqtrfepgneyaiyvrqpqaesehwdtlidgnqra
eqrefytlgglevspdnqklavaedflsrrqydirfknlsddswtdevlentsgsfewan
dsatvyyvrkhaktllpyqvyrhvvgtdpqldeliyeeqddtfyvglekttsdrfilihl
sstttseillldadradstpqmfvprrkdheygidhyhqhfyirsnkdgknfglyqseqa
deaqwqtliaprievmlegfslfrdwlvveersegltqlrqihwqsgevkriafddptyt
twlaynpepetellrygyssmttpttlyelnldsdervmlkqqevknftp

SCOPe Domain Coordinates for d7ob1a1:

Click to download the PDB-style file with coordinates for d7ob1a1.
(The format of our PDB-style files is described here.)

Timeline for d7ob1a1: