Class b: All beta proteins [48724] (178 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.7: Peptidase/esterase 'gauge' domain [50993] (3 families) |
Family b.69.7.0: automated matches [227149] (1 protein) not a true family |
Protein automated matches [226853] (5 species) not a true protein |
Species Serratia proteamaculans [TaxId:28151] [395711] (5 PDB entries) |
Domain d7ob1a1: 7ob1 A:2-411 [406114] Other proteins in same PDB: d7ob1a2, d7ob1a3 automated match to d3iuja1 complexed with spm |
PDB Entry: 7ob1 (more details), 2 Å
SCOPe Domain Sequences for d7ob1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ob1a1 b.69.7.0 (A:2-411) automated matches {Serratia proteamaculans [TaxId: 28151]} mtppkaekrpypitthgdtrvddyywlrddertdpqvldylqaenaftdaalkpqqalre tlyeemvarenlyfqsvpyvrhgyryqtrfepgneyaiyvrqpqaesehwdtlidgnqra eqrefytlgglevspdnqklavaedflsrrqydirfknlsddswtdevlentsgsfewan dsatvyyvrkhaktllpyqvyrhvvgtdpqldeliyeeqddtfyvglekttsdrfilihl sstttseillldadradstpqmfvprrkdheygidhyhqhfyirsnkdgknfglyqseqa deaqwqtliaprievmlegfslfrdwlvveersegltqlrqihwqsgevkriafddptyt twlaynpepetellrygyssmttpttlyelnldsdervmlkqqevknftp
Timeline for d7ob1a1: