SCOPe 2.08: Domain d7ok7b1: 7ok7 B:7-182

Lineage for d7ok7b1 (7ok7 B:7-182)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (17 species)

7. Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (6 PDB entries)

8. Domain d7ok7b1: 7ok7 B:7-182 [406091]
   Other proteins in same PDB: d7ok7b2, d7ok7c2
   automated match to d4zi2b_
   complexed with edo, gnp, gol, mg, po4

Details for d7ok7b1

PDB Entry: 7ok7, 3.15 Å

PDB Description: crystal structure of the unc119b arl3 complex

PDB Compounds: (B:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d7ok7b1:

Sequence; same for both SEQRES and ATOM records:

>d7ok7b1 c.37.1.8 (B:7-182) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
lrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfklnvw
diggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvlifan
kqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnakkk

Timeline for d7ok7b1:

• d7ok7b1 first appeared in SCOPe 2.07