![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins) |
![]() | Protein High level kasugamycin resistance protein KsgA [110662] (2 species) |
![]() | Species Escherichia coli [TaxId:83333] [406088] (1 PDB entry) |
![]() | Domain d7o5hv_: 7o5h V: [406089] automated match to d1qyra_ complexed with mg |
PDB Entry: 7o5h (more details), 3.1 Å
SCOPe Domain Sequences for d7o5hv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7o5hv_ c.66.1.24 (V:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 83333]} nflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaarlqt hpflgpkltiyqqdamtfnfgelaekmgqplrvfgnlpynistplmfhlfsytdaiadmh fmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrlvph atmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisvaqy cqmanylaena
Timeline for d7o5hv_: