Lineage for d7o5hv_ (7o5h V:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893551Family c.66.1.24: rRNA adenine dimethylase-like [88784] (5 proteins)
  6. 2893552Protein High level kasugamycin resistance protein KsgA [110662] (2 species)
  7. 2893556Species Escherichia coli [TaxId:83333] [406088] (1 PDB entry)
  8. 2893557Domain d7o5hv_: 7o5h V: [406089]
    automated match to d1qyra_
    complexed with mg

Details for d7o5hv_

PDB Entry: 7o5h (more details), 3.1 Å

PDB Description: ribosomal methyltransferase ksga bound to small ribosomal subunit
PDB Compounds: (V:) Ribosomal RNA small subunit methyltransferase A

SCOPe Domain Sequences for d7o5hv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7o5hv_ c.66.1.24 (V:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 83333]}
nflndqfvidsivsainpqkgqamveigpglaaltepvgerldqltvieldrdlaarlqt
hpflgpkltiyqqdamtfnfgelaekmgqplrvfgnlpynistplmfhlfsytdaiadmh
fmlqkevvnrlvagpnskaygrlsvmaqyycnvipvlevppsaftpppkvdsavvrlvph
atmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisvaqy
cqmanylaena

SCOPe Domain Coordinates for d7o5hv_:

Click to download the PDB-style file with coordinates for d7o5hv_.
(The format of our PDB-style files is described here.)

Timeline for d7o5hv_: