Lineage for d1a9cf_ (1a9c F:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332602Fold d.96: T-fold [55619] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 332603Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 332604Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein)
  6. 332605Protein GTP cyclohydrolase I [55622] (3 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 332606Species Escherichia coli [TaxId:562] [55623] (4 PDB entries)
  8. 332627Domain d1a9cf_: 1a9c F: [40607]

Details for d1a9cf_

PDB Entry: 1a9c (more details), 2.9 Å

PDB Description: gtp cyclohydrolase i (c110s mutant) in complex with gtp

SCOP Domain Sequences for d1a9cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a9cf_ d.96.1.1 (F:) GTP cyclohydrolase I {Escherichia coli}
pslskeaalvhealvargletplrppvhemdnetrksliaghmteimqllnldladdslm
etphriakmyvdeifsgldyanfpkitlienkmkvdemvtvrditltstsehhfvtidgk
atvayipkdsviglskinrivqffaqrpqvqerltqqilialqtllgtnnvavsidavhy
cvkargirdatsattttslgglfkssqntrheflravrhhn

SCOP Domain Coordinates for d1a9cf_:

Click to download the PDB-style file with coordinates for d1a9cf_.
(The format of our PDB-style files is described here.)

Timeline for d1a9cf_: